PDB entry 2vgn

View 2vgn on RCSB PDB site
Description: structure of yeast dom34 : a protein related to translation termination factor erf1 and involved in no-go decay.
Class: cell cycle
Keywords: translation termination factor, protein biosynthesis, translation regulation, cell division, mRNA degradation, nucleotide binding, mitosis, meiosis, cytoplasm, cell cycle, no-go decay
Deposited on 2007-11-14, released 2008-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2097
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dom34
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vgna1, d2vgna2, d2vgna3
  • Chain 'B':
    Compound: dom34
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vgnb1, d2vgnb2, d2vgnb3
  • Heterogens: GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vgnA (A:)
    mkvislkkdsfnkggavitllpedkedlftvyqivdkddelifkkkftskldeagkkkst
    dlvklkikvisedfdmkdeylkykgvtvtdesgasnvdipvgkylsftldyvypftiikq
    nfnkfmqkllneacnieyksdtaavvlqegiahvclvtssstilkqkieysmpkkkrttd
    vlkfdektekfykaiysamkkdlnfdklktiilcspgfyakilmdkifqyaeeehnkkil
    dnkgmffiahcstgylqginevlknplyasklqdtkyskeimvmdefllhlnkdddkawy
    gekevvkaaeygaisyllltdkvlhsdniaqreeylklmdsvesnggkalvlstlhslge
    eldqltgiacilkyplpdldeddgee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgnA (A:)
    mkvislkkdsfnkggavitllpedkedlftvyqivdkddelifkkkfdlvklkikvised
    fdmkdeylkykgvtvtdesgasnvdipvgkylsftldyvypftiikqnfnkfmqkllnea
    cnieyksdtaavvlqegiahvclvtssstilkqkieydvlkfdektekfykaiysamkkd
    lnfdklktiilcspgfyakilmdkifqyaeeehnkkildnkgmffiahcstgylqginev
    lknplyasklqdtkyskeimvmdefllhlnkdddkawygekevvkaaeygaisyllltdk
    vlhsdniaqreeylklmdsvesnggkalvlstlhslgeeldqltgiacilkyplpdlded
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vgnB (B:)
    mkvislkkdsfnkggavitllpedkedlftvyqivdkddelifkkkftskldeagkkkst
    dlvklkikvisedfdmkdeylkykgvtvtdesgasnvdipvgkylsftldyvypftiikq
    nfnkfmqkllneacnieyksdtaavvlqegiahvclvtssstilkqkieysmpkkkrttd
    vlkfdektekfykaiysamkkdlnfdklktiilcspgfyakilmdkifqyaeeehnkkil
    dnkgmffiahcstgylqginevlknplyasklqdtkyskeimvmdefllhlnkdddkawy
    gekevvkaaeygaisyllltdkvlhsdniaqreeylklmdsvesnggkalvlstlhslge
    eldqltgiacilkyplpdldeddgee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgnB (B:)
    mkvislkkdkggavitllpedkedlftvyqivdkddelifkkkftdlvklkikvisedfd
    mkdeylkykgvtvtdesgasnvdipvgkylsftldyvypftiikqnfnkfmqkllneacn
    ieyksdtaavvlqegiahvclvtssstilkqkieyvlkfdektekfykaiysamkkdlnf
    dklktiilcspgfyakilmdkifqyaeeehnkkildnkgmffiahcstgylqginevlkn
    plyasklqdtkyskeimvmdefllhlnkdddkawygekevvkaaeygaisyllltdkvlh
    sdniaqreeylklmdsvesnggkalvlstlhslgeeldqltgiacilkyplpdlde