PDB entry 2vf6

View 2vf6 on RCSB PDB site
Description: human fdps synthase in complex with minodronate
Class: transferase
Keywords: sgc, structural genomics, structural genomics consortium, trans-prenyltransferase, transferase
Deposited on 2007-10-31, released 2007-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.202
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Farnesyl pyrophosphate synthetase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vf6a_
  • Heterogens: M0N, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vf6A (A:)
    mgsshhhhhhssgrenlyfqghmghmngdqnsdvyaqekqdfvqhfsqivrvltedemgh
    peigdaiarlkevleynaiggkynrgltvvvafrelveprkqdadslqrawtvgwcvell
    qafflvaddimdssltrrgqicwyqkpgvgldaindanlleaciyrllklycreqpyyln
    lielflqssyqteigqtldlltapqgnvdlvrftekryksivkyktafysfylpiaaamy
    magidgekehanakkillemgeffqiqddyldlfgdpsvtgkigtdiqdnkcswlvvqcl
    qratpeqyqilkenygqkeaekvarvkalyeeldlpavflqyeedsyshimalieqyaap
    lppavflglarkiykrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vf6A (A:)
    vyaqekqdfvqhfsqivrvltepeigdaiarlkevleynaiggkynrgltvvvafrelve
    prkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgldaindan
    lleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvrftekry
    ksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyldlfgdps
    vtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyeeldlpav
    flqyeedsyshimalieqyaaplppavflglarkiyk