PDB entry 2veu

View 2veu on RCSB PDB site
Description: Crystal structure of protein tyrosine phosphatase 1B in complex with an isothiazolidinone-containing inhibitor
Class: hydrolase
Keywords: membrane, oxidation, hydrolase, phosphatase, phosphorylation, protein phosphatase, endoplasmic reticulum
Deposited on 2007-10-27, released 2007-11-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.2327
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2veua_
  • Heterogens: IZ1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2veuA (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedle
    pppehipppprppkrilephn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2veuA (A:)
    mekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhqe
    dndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkca
    qywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdf
    gvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdps
    svdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedl