PDB entry 2vbu

View 2vbu on RCSB PDB site
Description: riboflavin kinase mj0056 from methanocaldococcus jannaschii in complex with cdp
Class: transferase
Keywords: transferase, cradle-loop barrel, ctp-dependent kinase, fmn
Deposited on 2007-09-16, released 2007-11-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.163
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Riboflavin kinase
    Species: Methanococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2vbua_
  • Heterogens: CDP, MG, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vbuA (A:)
    mvklmiiegevvsglgegryflslppykeifkkilgfepyegtlnlkldrefdinkfkyi
    etedfefngkrffgvkvlpikilignkkidgaivvpkktyhsseiieiiapmklreqfnl
    kdgdvikilikgdkde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vbuA (A:)
    vklmiiegevvsglgegryflslppykeifkkilgfepyegtlnlkldrefdinkfkyie
    tedfefngkrffgvkvlpikilignkkidgaivvpkktyhsseiieiiapmklreqfnlk
    dgdvikilikg