PDB entry 2vbt

View 2vbt on RCSB PDB site
Description: riboflavin kinase mj0056 from methanocaldococcus jannaschii in complex with cdp and po4
Class: transferase
Keywords: transferase, cradle-loop barrel, ctp-dependent kinase, fmn
Deposited on 2007-09-16, released 2007-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.211
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Riboflavin kinase
    Species: Methanococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vbta_
  • Heterogens: CDP, NA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vbtA (A:)
    mvklmiiegevvsglgegryflslppykeifkkilgfepyegtlnlkldrefdinkfkyi
    etedfefngkrffgvkvlpikilignkkidgaivvpkktyhsseiieiiapmklreqfnl
    kdgdvikilikgdkde