PDB entry 2vbs

View 2vbs on RCSB PDB site
Description: riboflavin kinase mj0056 from methanocaldococcus jannaschii in complex with po4
Class: transferase
Keywords: fmn, cradle-loop barrel, ctp-dependent kinase, transferase
Deposited on 2007-09-16, released 2007-11-20
The last revision prior to the SCOP 1.75 freeze date was dated 2008-06-03, with a file datestamp of 2008-05-30.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.23247
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Riboflavin kinase
    Species: Methanococcus jannaschii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2vbsa1
  • Heterogens: PO4, ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vbsA (A:)
    mvklmiiegevvsglgegryflslppykeifkkilgfepyegtlnlkldrefdinkfkyi
    etedfefngkrffgvkvlpikilignkkidgaivvpkktyhsseiieiiapmklreqfnl
    kdgdvikilikgdkde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vbsA (A:)
    vklmiiegevvsglgegryflslppykeifkkilgfepyegtlnlkldrefdinkfkyie
    tedfefngkrffgvkvlpikilignkkidgaivvpkktyhsseiieiiapmklreqfnlk
    dgdvikilikgd