PDB entry 2vb5

View 2vb5 on RCSB PDB site
Description: solution structure of w60g mutant of human beta2-microglobulin
Class: immune system
Keywords: immunoglobulin constant domain, immune system, amyloid disease, immune response, MHC I, secreted, glycation, glycoprotein, immunoglobulin domain,
Deposited on 2007-09-06, released 2007-09-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VB5 (0-0)
      • engineered mutation (60)
    • Uniprot P61769 (1-99)
    Domains in SCOPe 2.05: d2vb5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2vb5A (A:)
miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
gsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm