PDB entry 2v9v

View 2v9v on RCSB PDB site
Description: crystal structure of moorella thermoacetica selb(377-511)
Class: transcription
Keywords: transcription, protein conformational change, transcription elongation factor selb, selenoprotein biosynthesis, protein dynamics, nucleotide-binding, cytoplasm, GTP-binding, selenocysteine, winged-helix domain, protein biosynthesis
Deposited on 2007-08-27, released 2007-09-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.121
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Selenocysteine-specific elongation factor
  Species: Moorella thermoacetica [TaxId:1525]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q46455 (0-134)
  Domains in SCOPe 2.04: d2v9va1, d2v9va2
• Heterogens: CL, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2v9vA (A:)
  gspekilaqiiqehregldwqeaatraslsleetrkllqsmaaagqvtllrvendlyais
  teryqawwqavtraleefhsryplrpglareelrsryfsrlparvyqalleewsregrlq
  laantvalagftpsf