PDB entry 2v92

View 2v92 on RCSB PDB site
Description: crystal structure of the regulatory fragment of mammalian ampk in complexes with ATP-amp
Class: transferase
Keywords: phosphorylation, nucleotide-binding, serine/threonine-protein kinase, ATP-binding, kinase, magnesium, cbs domain, transferase
Deposited on 2007-08-20, released 2007-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-amp-activated protein kinase catalytic subunit alpha-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V92
    • Uniprot P54645 (4-156)
    Domains in SCOPe 2.07: d2v92a_
  • Chain 'B':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v92b_
  • Chain 'E':
    Compound: 5'-amp-activated protein kinase subunit gamma-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v92e1, d2v92e2
  • Heterogens: ATP, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v92A (A:)
    gsmawhlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslql
    yqvdsrtylldfrsiddeiteaksgtatpqrsgsisnyrscqrsdsdaeaqgkpsevslt
    ssvtsldsspvdvaprpgshtieffemcanlikilaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v92A (A:)
    smawhlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqly
    qvdsrtylldfrsiddevaprpgshtieffemcanlikilaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v92B (B:)
    mgpygqemyafrseerfksppilpphllqvilnkdtniscdpallpepnhvmlnhlyals
    ikdsvmvlsathrykkkyvttllykpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v92B (B:)
    gqemyafrseerfksppilpphllqvilnkdtnpnhvmlnhlyalsikdsvmvlsathry
    kkkyvttllykpi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2v92E (E:)
    mesvaaesapapenehsqetpesnssvyttfmkshrcydliptssklvvfdtslqvkkaf
    falvtngvraaplwdskkqsfvgmltitdfinilhryyksalvqiyeleehkietwrevy
    lqdsfkplvcispnaslfdavsslirnkihrlpvidpesgntlyilthkrilkflklfit
    efpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiy
    skfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetleaiinrlveaevhrlv
    vvdehdvvkgivslsdilqalvltggekkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v92E (E:)
    snssvyttfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfv
    gmltitdfinilhryyksalvqiyeleehkietwrevylqdsfkplvcispnaslfdavs
    slirnkihrlpvidpesgntlyilthkrilkflklfitefpkpefmsksleelqigtyan
    iamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiyskfdvinlaaektynnldvsvt
    kalqhrshyfegvlkcylhetleaiinrlveaevhrlvvvdehdvvkgivslsdilqalv
    ltgg