PDB entry 2v86

View 2v86 on RCSB PDB site
Description: Crystal structure of RAG2-PHD finger in complex with H3R2me2aK4me3 peptide
Class: protein binding
Keywords: v(d)j recombination, covalent modifications, rag2, histone, nucleus, nuclease, hydrolase, phd finger, DNA-binding, recombinase, endonuclease, trimethyl lysine, dimethyl arginine, DNA recombination, protein binding
Deposited on 2007-08-02, released 2007-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vdj recombination-activating protein 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21784 (8-81)
      • expression tag (0-7)
    Domains in SCOPe 2.08: d2v86a2, d2v86a3
  • Chain 'B':
    Compound: vdj recombination-activating protein 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21784 (8-81)
      • expression tag (0-7)
    Domains in SCOPe 2.08: d2v86b2, d2v86b3
  • Chain 'D':
    Compound: h3r2me2ak4me3 peptide
    Species: Mus musculus, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84228 (0-8)
      • conflict (8)
  • Chain 'E':
    Compound: h3r2me2ak4me3 peptide
    Species: Mus musculus, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84228 (0-8)
      • conflict (8)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v86A (A:)
    gplgspefgywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleert
    lihlsegsnkyycnehvqiara
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v86B (B:)
    gplgspefgywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleert
    lihlsegsnkyycnehvqiara
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.