PDB entry 2v7d

View 2v7d on RCSB PDB site
Description: 14-3-3 protein zeta in complex with thr758 phosphorylated integrin beta2 peptide
Class: signaling protein
Keywords: membrane, integrin, receptor, cytoplasm, acetylation, transmembrane, beta2 integrin, phosphorylation, disease mutation, pyrrolidone carboxylic acid, 14-3-3 zeta, glycoprotein, cell adhesion, signaling protein
Deposited on 2007-07-30, released 2008-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2277
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein zeta/delta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V7D (0-1)
    • Uniprot P63103 (2-End)
    Domains in SCOPe 2.07: d2v7da_
  • Chain 'B':
    Compound: 14-3-3 protein zeta/delta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V7D (0-1)
    • Uniprot P63103 (2-End)
    Domains in SCOPe 2.07: d2v7db_
  • Chain 'C':
    Compound: 14-3-3 protein zeta/delta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V7D (0-1)
    • Uniprot P63103 (2-End)
    Domains in SCOPe 2.07: d2v7dc_
  • Chain 'D':
    Compound: 14-3-3 protein zeta/delta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V7D (0-1)
    • Uniprot P63103 (2-End)
    Domains in SCOPe 2.07: d2v7dd_
  • Chain 'P':
    Compound: integrin beta chain, beta 2 variant
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: integrin beta chain, beta 2 variant
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: integrin beta chain, beta 2 variant
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: integrin beta chain, beta 2 variant
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v7dA (A:)
    gsmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrss
    wrvvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfy
    lkmkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtsdtqgdeae
    ageggen
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v7dA (A:)
    gsmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrss
    wrvvssieqkaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm
    kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei
    lnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v7dB (B:)
    gsmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrss
    wrvvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfy
    lkmkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtsdtqgdeae
    ageggen
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v7dB (B:)
    gsmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrss
    wrvvssieqkteekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlesykdstlimqllrdnltlwt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2v7dC (C:)
    gsmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrss
    wrvvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfy
    lkmkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtsdtqgdeae
    ageggen
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v7dC (C:)
    gsmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrss
    wrvvssieqktekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm
    kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei
    lnspekacslaktafdeaiaeldtleesykdstlimqllrdnltlwt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2v7dD (D:)
    gsmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrss
    wrvvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfy
    lkmkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtsdtqgdeae
    ageggen
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v7dD (D:)
    gsmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrss
    wrvvssieqktaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlesykdstlimqllrdnltlwts
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.