PDB entry 2v6m

View 2v6m on RCSB PDB site
Description: crystal structure of lactate dehydrogenase from thermus thermophilus hb8 (apo form)
Class: oxidoreductase
Keywords: oxidoreductase, phosphorylation, nad, lactate, cytoplasm, glycolysis, thermophile
Deposited on 2007-07-19, released 2007-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v6ma1, d2v6ma2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v6mb1, d2v6mb2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v6mc1, d2v6mc2
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v6md1, d2v6md2
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v6mA (A:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v6mB (B:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v6mB (B:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvrlqlldrnaqvfaqvvprvleaapeavllvatnpvdvmtqvay
    rlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvgg
    vpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvrailtdek
    gvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaeilkeaafa
    lgf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v6mC (C:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2v6mD (D:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v6mD (D:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqqlldrnaqvfaqvvprvleaapeavllvatnpvdvmtqvay
    rlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvgg
    vpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvrailtdek
    gvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaeilkeaafa
    lgf