PDB entry 2v5h

View 2v5h on RCSB PDB site
Description: Controlling the storage of nitrogen as arginine: the complex of PII and acetylglutamate kinase from Synechococcus elongatus PCC 7942
Class: transcription
Keywords: amino-acid biosynthesis, transcription regulation, transferase, cyanobacteria, transcription, n-acetyl-l-glutamate kinase, pii signal protein, nucleotide-binding, acetylglutamate, phosphorylation, amino acid kinase, glnb, kinase, trimer, hexamer, ATP-binding, arginine inhibition, arginine biosynthesis
Deposited on 2007-07-04, released 2007-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.202
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylglutamate kinase
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v5ha_
  • Chain 'B':
    Compound: acetylglutamate kinase
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v5hb_
  • Chain 'C':
    Compound: acetylglutamate kinase
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v5hc_
  • Chain 'D':
    Compound: acetylglutamate kinase
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v5hd_
  • Chain 'E':
    Compound: acetylglutamate kinase
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v5he_
  • Chain 'F':
    Compound: acetylglutamate kinase
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v5hf_
  • Chain 'G':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v5hg_
  • Chain 'H':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v5hh_
  • Chain 'I':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v5hi_
  • Chain 'J':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v5hj_
  • Chain 'K':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v5hk_
  • Chain 'L':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v5hl_
  • Heterogens: NLG, NA, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v5hA (A:)
    mgsshhhhhhssglvprgshmssefieagaadrvrilsealpylqqfagrtvvvkyggaa
    mkqeelkeavmrdivflacvgmrpvvvhgggpeinawlgrvgiepqfhnglrvtdadtme
    vvemvlvgrvnkdivsrinttggravgfcgtdgrlvlarphdqegigfvgevnsvnsevi
    epllergyipvissvaadengqsfninadtvageiaaalnaeklilltdtrgiledpkrp
    esliprlnipqsreliaqgivgggmipkvdccirslaqgvraahiidgriphallleift
    dagigtmivgsgyheahqpwq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v5hA (A:)
    agaadrvrilsealpylqqfagrtvvvkyggaamkqeelkeavmrdivflacvgmrpvvv
    hgggpeinawlgrvgiepqfhnglrvtdadtmevvemvlvgrvnkdivsrinttggravg
    fcgtdgrlvlarphdqegigfvgevnsvnseviepllergyipvissvaadengqsfnin
    adtvageiaaalnaeklilltdtrgiledpkrpesliprlnipqsreliaqgivgggmip
    kvdccirslaqgvraahiidgriphallleiftdagigtmivgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v5hB (B:)
    mgsshhhhhhssglvprgshmssefieagaadrvrilsealpylqqfagrtvvvkyggaa
    mkqeelkeavmrdivflacvgmrpvvvhgggpeinawlgrvgiepqfhnglrvtdadtme
    vvemvlvgrvnkdivsrinttggravgfcgtdgrlvlarphdqegigfvgevnsvnsevi
    epllergyipvissvaadengqsfninadtvageiaaalnaeklilltdtrgiledpkrp
    esliprlnipqsreliaqgivgggmipkvdccirslaqgvraahiidgriphallleift
    dagigtmivgsgyheahqpwq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v5hB (B:)
    agaadrvrilsealpylqqfagrtvvvkyggaamkqeelkeavmrdivflacvgmrpvvv
    hgggpeinawlgrvgiepqfhnglrvtdadtmevvemvlvgrvnkdivsrinttggravg
    fcgtdgrlvlarphdqegigfvgevnsvnseviepllergyipvissvaadengqsfnin
    adtvageiaaalnaeklilltdtrgiledpkrpesliprlnipqsreliaqgivgggmip
    kvdccirslaqgvraahiidgriphallleiftdagigtmivgsgyhea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2v5hC (C:)
    mgsshhhhhhssglvprgshmssefieagaadrvrilsealpylqqfagrtvvvkyggaa
    mkqeelkeavmrdivflacvgmrpvvvhgggpeinawlgrvgiepqfhnglrvtdadtme
    vvemvlvgrvnkdivsrinttggravgfcgtdgrlvlarphdqegigfvgevnsvnsevi
    epllergyipvissvaadengqsfninadtvageiaaalnaeklilltdtrgiledpkrp
    esliprlnipqsreliaqgivgggmipkvdccirslaqgvraahiidgriphallleift
    dagigtmivgsgyheahqpwq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v5hC (C:)
    agaadrvrilsealpylqqfagrtvvvkyggaamkqeelkeavmrdivflacvgmrpvvv
    hgggpeinawlgrvgiepqfhnglrvtdadtmevvemvlvgrvnkdivsrinttggravg
    fcgtdgrlvlarphdqegigfvgevnsvnseviepllergyipvissvaadengqsfnin
    adtvageiaaalnaeklilltdtrgiledpkrpesliprlnipqsreliaqgivgggmip
    kvdccirslaqgvraahiidgriphallleiftdagigtmivgs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2v5hD (D:)
    mgsshhhhhhssglvprgshmssefieagaadrvrilsealpylqqfagrtvvvkyggaa
    mkqeelkeavmrdivflacvgmrpvvvhgggpeinawlgrvgiepqfhnglrvtdadtme
    vvemvlvgrvnkdivsrinttggravgfcgtdgrlvlarphdqegigfvgevnsvnsevi
    epllergyipvissvaadengqsfninadtvageiaaalnaeklilltdtrgiledpkrp
    esliprlnipqsreliaqgivgggmipkvdccirslaqgvraahiidgriphallleift
    dagigtmivgsgyheahqpwq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v5hD (D:)
    agaadrvrilsealpylqqfagrtvvvkyggaamkqeelkeavmrdivflacvgmrpvvv
    hgggpeinawlgrvgiepqfhnglrvtdadtmevvemvlvgrvnkdivsrinttggravg
    fcgtdgrlvlarphdqegigfvgevnsvnseviepllergyipvissvaadengqsfnin
    adtvageiaaalnaeklilltdtrgiledpkrpesliprlnipqsreliaqgivgggmip
    kvdccirslaqgvraahiidgriphallleiftdagigtmivgsgy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2v5hE (E:)
    mgsshhhhhhssglvprgshmssefieagaadrvrilsealpylqqfagrtvvvkyggaa
    mkqeelkeavmrdivflacvgmrpvvvhgggpeinawlgrvgiepqfhnglrvtdadtme
    vvemvlvgrvnkdivsrinttggravgfcgtdgrlvlarphdqegigfvgevnsvnsevi
    epllergyipvissvaadengqsfninadtvageiaaalnaeklilltdtrgiledpkrp
    esliprlnipqsreliaqgivgggmipkvdccirslaqgvraahiidgriphallleift
    dagigtmivgsgyheahqpwq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v5hE (E:)
    agaadrvrilsealpylqqfagrtvvvkyggaamkqeelkeavmrdivflacvgmrpvvv
    hgggpeinawlgrvgiepqfhnglrvtdadtmevvemvlvgrvnkdivsrinttggravg
    fcgtdgrlvlarphdqegigfvgevnsvnseviepllergyipvissvaadengqsfnin
    adtvageiaaalnaeklilltdtrgiledpkrpesliprlnipqsreliaqgivgggmip
    kvdccirslaqgvraahiidgriphallleiftdagigtmivgsgy
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2v5hF (F:)
    mgsshhhhhhssglvprgshmssefieagaadrvrilsealpylqqfagrtvvvkyggaa
    mkqeelkeavmrdivflacvgmrpvvvhgggpeinawlgrvgiepqfhnglrvtdadtme
    vvemvlvgrvnkdivsrinttggravgfcgtdgrlvlarphdqegigfvgevnsvnsevi
    epllergyipvissvaadengqsfninadtvageiaaalnaeklilltdtrgiledpkrp
    esliprlnipqsreliaqgivgggmipkvdccirslaqgvraahiidgriphallleift
    dagigtmivgsgyheahqpwq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v5hF (F:)
    ieagaadrvrilsealpylqqfagrtvvvkyggaamkqeelkeavmrdivflacvgmrpv
    vvhgggpeinawlgrvgiepqfhnglrvtdadtmevvemvlvgrvnkdivsrinttggra
    vgfcgtdgrlvlarphdqegigfvgevnsvnseviepllergyipvissvaadengqsfn
    inadtvageiaaalnaeklilltdtrgiledpkrpesliprlnipqsreliaqgivgggm
    ipkvdccirslaqgvraahiidgriphallleiftdagigtmivgsg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2v5hG (G:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v5hG (G:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknada
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2v5hH (H:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v5hH (H:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgekn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2v5hI (I:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v5hI (I:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkteryrgseytveflqklkle
    ivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknada
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2v5hJ (J:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v5hJ (J:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknad
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2v5hK (K:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v5hK (K:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgekn
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2v5hL (L:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v5hL (L:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgekna