PDB entry 2v4v

View 2v4v on RCSB PDB site
Description: crystal structure of a family 6 carbohydrate-binding module from clostridium cellulolyticum in complex with xylose
Class: hydrolase
Keywords: hydrolase, family 6 carbohydrate binding module, cccbm6
Deposited on 2008-09-29, released 2009-10-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-06-22, with a file datestamp of 2011-06-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.192
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gh59 galactosidase
    Species: Clostridium cellulolyticum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2v4va_
  • Heterogens: XYP, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v4vA (A:)
    qsaysrieaesysnqsgiqtetcseggedvgfvengdytvynnvdfgdgvggfqarvasa
    tsggnieirldsstgtligtcpvagtgdwqtytdakctvsgvtgkhdvylvfkgdsgylf
    nlnwftfse