PDB entry 2v3b

View 2v3b on RCSB PDB site
Description: crystal structure of the electron transfer complex rubredoxin - rubredoxin reductase from pseudomonas aeruginosa.
Class: oxidoreductase
Keywords: alkane degradation, iron-sulfur protein, oxidoreductase, electron transfer, electron transport, fad, nad, iron, flavoprotein, metal-binding
Deposited on 2007-06-14, released 2007-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.185
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin reductase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Rubredoxin 2
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v3bb_
  • Heterogens: FAD, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v3bB (B:)
    mrkwqcvvcgfiydealglpeegipagtrwedipadwvcpdcgvgkidfemieia
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v3bB (B:)
    mrkwqcvvcgfiydealglpeegipagtrwedipadwvcpdcgvgkidfemie