PDB entry 2v37

View 2v37 on RCSB PDB site
Description: Solution structure of the N-terminal extracellular domain of human T- cadherin
Class: cell adhesion
Keywords: lipoprotein, polymorphism, glycoprotein, cell adhesion, adiponectin receptor, extracellular protein, calcium, membrane, t-cadherin, gpi-anchor, classical cadherin, cell-cell adhesion, cleavage on pair of basic residues
Deposited on 2007-06-13, released 2008-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cadherin-13
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55290 (0-104)
  Domains in SCOPe 2.08: d2v37a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2v37A (A:)
  sivvspilipenqrqpfprdvgkvvdsdrperskfrltgkgvdqepkgifrinentgsvs
  vtrtldreviavyqlfvettdvngktlegpvplevividqndnrp