PDB entry 2v2m

View 2v2m on RCSB PDB site
Description: Mutant (E53,56,57,60Q) recombinant horse spleen apoferritin cocrystallized with haemin in basic conditions
Class: metal transport
Keywords: metal transport, iron, haemin, apoferritin, iron storage, metal-binding
Deposited on 2007-06-06, released 2008-06-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.187
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin light chain
    Species: Equus caballus [TaxId:9796]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02791
      • engineered mutation (52)
      • engineered mutation (55-56)
      • engineered mutation (59)
    Domains in SCOPe 2.03: d2v2ma_
  • Heterogens: CD, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v2mA (A:)
    ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrqlaqqkrq
    gaerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaq
    adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v2mA (A:)
    sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrqlaqqkrqg
    aerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqa
    dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltl