PDB entry 2v2i

View 2v2i on RCSB PDB site
Description: Wild type recombinant horse spleen apoferritin cocrystallized with haemin in acidic conditions
Class: metal transport
Keywords: metal transport, iron, haemin, apoferritin, iron storage, metal-binding
Deposited on 2007-06-06, released 2008-06-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin light chain
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2v2ia_
  • Heterogens: CD, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v2iA (A:)
    mssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekr
    egaerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsa
    qadphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v2iA (A:)
    sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekreg
    aerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqa
    dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltl