PDB entry 2v20

View 2v20 on RCSB PDB site
Description: structure of a tem-1 beta-lactamase insertant allosterically regulated by kanamycin and anions. complex with sulfate.
Class: hydrolase
Keywords: hydrolase, insertion mutant, antibiotic resistance, allosteric regulation
Deposited on 2007-05-31, released 2008-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.182
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (22-267)
      • insertion (14-21)
      • engineered mutation (63)
      • engineered mutation (83)
      • engineered mutation (163)
      • engineered mutation (218)
      • engineered mutation (246-249)
      • expression tag (268)
    Domains in SCOPe 2.06: d2v20a1, d2v20a2
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v20A (A:)
    petlvkvkdaedqlcrtshrpcrvgyieldlnsgkilesfrpeerfpmmstfkvllcgav
    lsridagqeqlgrrihysqndlvkyspvtekhltdgmtvrelcsaaitmsdntaanlllt
    tiggpkeltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgellt
    lasrqqlidwmeadkvagpllrsalpagwfiadksgagrrgsrgiiaalgpdgkpsrivv
    iyttgsrkktdernrqiaeigaslikhwgleqkliseedlnsavdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v20A (A:)
    petlvkvkdaedqlcrtshrpcrvgyieldlnsgkilesfrpeerfpmmstfkvllcgav
    lsridagqeqlgrrihysqndlvkyspvtekhltdgmtvrelcsaaitmsdntaanlllt
    tiggpkeltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgellt
    lasrqqlidwmeadkvagpllrsalpagwfiadksgagrrgsrgiiaalgpdgkpsrivv
    iyttgsrkktdernrqiaeigaslikhwg