PDB entry 2v17

View 2v17 on RCSB PDB site
Description: structure of the complex of antibody mn423 with a fragment of tau protein
Class: immune system
Keywords: microtubule, tau protein, alzheimer's disease, immune system
Deposited on 2007-05-22, released 2007-12-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-04-21, with a file datestamp of 2009-04-17.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.16
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptide fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V17
  • Chain 'H':
    Compound: monoclonal antibody fab fragment mn423
    Species: Mus musculus [TaxId:10090]
  • Chain 'L':
    Compound: monoclonal antibody fab fragment mn423
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.05: d2v17l1, d2v17l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v17L (L:)
    dvqitqspsylaaspgetitincrasksirkflawyrekpgktnklliysgstlqsgtps
    rfsgsgsgtdftltisrlepedfamyycqqhndypltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec