PDB entry 2v08

View 2v08 on RCSB PDB site
Description: structure of wild-type phormidium laminosum cytochrome c6
Class: photosynthesis
Keywords: cytochrome, photosynthesis, cyano-bacteria, electron-transfer
Deposited on 2007-05-10, released 2007-07-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.188
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c6
    Species: Phormidium laminosum [TaxId:32059]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V08 (Start-85)
    Domains in SCOPe 2.02: d2v08a_
  • Chain 'B':
    Compound: cytochrome c6
    Species: Phormidium laminosum [TaxId:32059]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V08 (Start-85)
    Domains in SCOPe 2.02: d2v08b_
  • Heterogens: HEM, IMD, ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v08A (A:)
    dadlatgakvfsancaachagginlvnaektlkkealekfgmnsivaittqvtngkagmp
    afkgrltddqiaavaayvldqaekgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v08A (A:)
    dlatgakvfsancaachagginlvnaektlkkealekfgmnsivaittqvtngkagmpaf
    kgrltddqiaavaayvldqaekgw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v08B (B:)
    dadlatgakvfsancaachagginlvnaektlkkealekfgmnsivaittqvtngkagmp
    afkgrltddqiaavaayvldqaekgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v08B (B:)
    dlatgakvfsancaachagginlvnaektlkkealekfgmnsivaittqvtngkagmpaf
    kgrltddqiaavaayvldqaekgw