PDB entry 2v03

View 2v03 on RCSB PDB site
Description: High resolution structure and catalysis of an O-acetylserine sulfhydrylase
Class: transferase
Keywords: pyridoxal phosphate, cysteine biosynthesis, transferase, enzyme kinetics, enzymatic sythesis of novel compounds, amino-acid biosynthesis
Deposited on 2007-05-08, released 2007-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine synthase B
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16703 (0-End)
      • engineered mutation (267)
    Domains in SCOPe 2.07: d2v03a_
  • Heterogens: PLP, GOL, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v03A (A:)
    mstleqtigntplvklqrmgpdngsevwlklegnnpagsvkdraalsmiveaekrgeikp
    gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
    gardlalemanrgegklldqfnnpdnpyahytttgpeiwqqtggrithfvssmgttgtit
    gvsrfmreqskpvtivglqpeegssipgirrwpteylpgifnaslvdevldihqrdaent
    mrelavregifcgvssggavagalrvaaanpdavvvaiicdrgdrylstgvfgeehfsqg
    agi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v03A (A:)
    mstleqtigntplvklqrmgpdngsevwlklegnnpagsvkdraalsmiveaekrgeikp
    gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
    gardlalemanrgegklldqfnnpdnpyahytttgpeiwqqtggrithfvssmgttgtit
    gvsrfmreqskpvtivglqpeegssipgirrwpteylpgifnaslvdevldihqrdaent
    mrelavregifcgvssggavagalrvaaanpdavvvaiicdrgdrylstgvfge