PDB entry 2uzw

View 2uzw on RCSB PDB site
Description: pka structures of indazole-pyridine series of akt inhibitors
Class: transferase
Keywords: camp, kinase, myristate, transferase, lipoprotein, serine/threonine-protein kinase, phosphorylation, protein kinase a, nucleotide-binding, ATP-binding, akt inhibitors, nuclear protein
Deposited on 2007-05-01, released 2007-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.3134
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: cAMP-dependent protein kinase, alpha-catalytic subunit
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00517 (0-335)
      • conflict (271)
    Domains in SCOPe 2.08: d2uzwe_
  • Chain 'I':
    Compound: cAMP-dependent protein kinase inhibitor alpha
    Species: BOS TAURUS, synthetic [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SS4

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2uzwE (E:)
vkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkil
dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr
igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
vrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfattdwiaiyqrkveapf
ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

  • Chain 'I':
    No sequence available.