PDB entry 2uzi

View 2uzi on RCSB PDB site
Description: crystal structure of hras(g12v) - anti-ras fv complex
Class: signaling protein/immune system
Keywords: signal transduction, immunoglobulin domain, membrane, antibody, oncogene, palmitate, intrabody, disease mutation, nucleotide-binding, proto-oncogene, cancer therapy, golgi apparatus, prenylation, methylation, lipoprotein, GTP- binding, signaling protein/immune system
Deposited on 2007-04-27, released 2007-06-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: anti-ras fv heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2UZI (3-106)
• Chain 'L':
  Compound: anti-ras fv light chain
  Species: Homo sapiens [TaxId:9606]
  
• Chain 'R':
  Compound: gtpase hras
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01112 (0-165)
    • engineered mutation (11)
  Domains in SCOPe 2.01: d2uzir_
• Heterogens: ZN, GTP, MG, HOH

PDB Chain Sequences:

• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'R':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2uziR (R:)
  mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
  qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
  aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh