PDB entry 2uy3

View 2uy3 on RCSB PDB site
Description: sccts1_8-chlorotheophylline crystal structure
Class: hydrolase
Keywords: carbohydrate metabolism, polysaccharide degradation, glycoprotein, chitin-binding, chitin degradation, cazy, hydrolase, glycosidase
Deposited on 2007-04-02, released 2007-04-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endochitinase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2uy3a_
  • Heterogens: H33, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2uy3A (A:)
    drsantniavywgqnsagtqeslatycessdadifllsflnqfptlglnfanacsdtfsd
    gllhctqiaedietcqslgkkvllslggasgsylfsddsqaetfaqtlwdtfgegtgase
    rpfdsavvdgfdfdiennnevgysalatklrtlfaegtkqyylsaapqcpypdasvgdll
    enadidfafiqfynnycsvsgqfnwdtwltyaqtvspnkniklflglpgsasaagsgyis
    dtsllestiadiassssfggialwdasqafsnelngepyveilknlltsasqta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uy3A (A:)
    ntniavywgqnsagtqeslatycessdadifllsflnqfptlglnfanacsdtfsdgllh
    ctqiaedietcqslgkkvllslggasgsylfsddsqaetfaqtlwdtfgegtgaserpfd
    savvdgfdfdiennnevgysalatklrtlfaegtkqyylsaapqcpypdasvgdllenad
    idfafiqfynnycsvsgqfnwdtwltyaqtvspnkniklflglpgsasaagsgyisdtsl
    lestiadiassssfggialwdasqafsnelngepyveilknllts