PDB entry 2ux1

View 2ux1 on RCSB PDB site
Description: identification of two zinc-binding sites in the streptococcus suis dpr protein
Class: oxidoreductase
Keywords: metal-binding, oxidoreductase
Deposited on 2007-03-26, released 2008-05-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.208
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ux1a_
  • Chain 'B':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ux1b_
  • Chain 'C':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ux1c_
  • Chain 'D':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ux1d_
  • Chain 'E':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ux1e_
  • Chain 'F':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ux1f_
  • Chain 'G':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F5J9 (0-164)
      • engineered mutation (0)
    Domains in SCOPe 2.01: d2ux1g_
  • Chain 'H':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ux1h_
  • Chain 'I':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ux1i_
  • Chain 'J':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ux1j_
  • Chain 'K':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ux1k_
  • Chain 'L':
    Compound: DNA protection during starvation protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ux1l_
  • Heterogens: ZN, CA, EPE, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ux1A (A:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ux1A (A:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ux1B (B:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ux1B (B:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ux1C (C:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ux1C (C:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ux1D (D:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ux1D (D:)
    sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
    itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
    dsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ux1E (E:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ux1E (E:)
    adskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserlit
    lggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegds
    vtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ux1F (F:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ux1F (F:)
    sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
    itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
    dsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ux1G (G:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ux1H (H:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ux1H (H:)
    sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
    itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
    dsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2ux1I (I:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ux1I (I:)
    psladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemser
    litlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdee
    gdsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2ux1J (J:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ux1J (J:)
    sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
    itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
    dsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2ux1K (K:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ux1K (K:)
    sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
    itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
    dsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2ux1L (L:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ux1L (L:)
    sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
    itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
    dsvtndifnvakasiekhiwmlqaelgqapkl