PDB entry 2uwx

View 2uwx on RCSB PDB site
Description: active site restructuring regulates ligand recognition in class a penicillin-binding proteins
Class: transferase
Keywords: transferase, peptidoglycan synthesis multifunctional enzyme, acyltransferase, glycosyltransferase, cell wall, peptidoglycan
Deposited on 2007-03-23, released 2007-04-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.168
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin-binding protein 1b
    Species: Streptococcus pneumoniae [TaxId:171101]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CRA4
      • engineered mutation (388-389)
    Domains in SCOPe 2.05: d2uwxa1
  • Heterogens: SO4, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2uwxA (A:)
    dissiseitysdgtviasiesdmlrqdflpsgtvtgisqdylyfttlaeaqermydylaq
    rdnvsakelkneatqkfyrdlaakeienggykitttidqkihsamqsavadygyllddgt
    grvevgnvlmdnqtgailgfvggrnyqenqnnhafdtkrspasttkpllaygiaidqglm
    gsetilsnyptnfangnpimyanskgtgmmtlgealnyswnipaywtyrmlrengvdvkg
    ymekmgyeipeygieslpmgggievtvaqhtngyqtlanngvyhqkhviskieaadgrvv
    yeyqdkpvqvyskatatimqgllrevlssrvtttfksnltslnptlanadwigktgttnq
    denmwlmlstprltlggwighddnhslsqqagysnnsnymahlvnaiqqaspsiwgnerf
    aldpsvvksevlkstgqkpgkvsvegkevevtgstvtsywanksgapatsyrfaiggsda
    dyqnawssivgslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uwxA (A:)
    iseitysdgtviasidylyfttlaeaqermydylaqrdnvsakelkneatqkfyrdlaak
    eienggykitttidqkihsamqsavadygyllddgtgrvevgnvlmdnqtgailgfvggr
    nyqenqnnhafdtkrspasttkpllaygiaidqglmgsetilsnyptnfangnpimyans
    kgtgmmtlgealnyswnipaywtyrmlrengvdvkgymekmgyeipeygieslpmgggie
    vtvaqhtngyqtlanngvyhqkhviskieaadgrvvyeyqdkpvqvyskatatimqgllr
    evlssrvtttfksnltslnptlanadwigktgttnqdenmwlmlstprltlggwighddn
    hslsqqagysnnsnymahlvnaiqqaspsiwgnerfaldpsvvksevlkstgqkpgkvsv
    egkevevtgstvtsywanksgapatsyrfaiggsdadyqnawssivgsl