PDB entry 2uws

View 2uws on RCSB PDB site
Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 6.5 in the charge-separated state
Class: photosynthesis
Keywords: bacteriochlorophyll, phosphatidylcholine, chlorophyll, cardiolipin, metal-binding, transmembrane, glucosylgalactosyl diacylglycerol, proton translocation pathways, photosynthesis, reaction center, electron transport, iron, membrane, transport, magnesium, chromophore, binding positions of the secondary quinone qb
Deposited on 2007-03-23, released 2007-07-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.204
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: reaction center protein h chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2uwsh1, d2uwsh2
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2uwsl_
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2uwsm_
  • Heterogens: GOL, LDA, BCL, BPH, UQ2, PO4, FE, U10, SPO, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2uwsH (H:)
    mvgvtafgnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpk
    pktfilphgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdl
    peldghghnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarfle
    velkdgstrllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagg
    lmyaapkrksvvaamlaeya
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uwsH (H:)
    dlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgr
    gtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnk
    ikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrl
    lpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkrks
    v
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2uwsL (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uwsL (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdedtffrdlvgysigtlgihrlglllslsav
    ffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2uwsM (M:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hgmapln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uwsM (M:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hgm