PDB entry 2uwm

View 2uwm on RCSB PDB site
Description: c-terminal domain(wh2-wh4) of elongation factor selb in complex with secis RNA
Class: translation
Keywords: protein biosynthesis, translation, GTP-binding, nucleotide- binding, selenocysteine-specific elongation factor
Deposited on 2007-03-22, released 2007-05-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.204
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Selenocysteine-specific elongation factor
    Species: Moorella thermoacetica [TaxId:1525]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2uwma1, d2uwma2, d2uwma3
  • Chain 'B':
    Compound: Selenocysteine-specific elongation factor
    Species: Moorella thermoacetica [TaxId:1525]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2uwmb1, d2uwmb2, d2uwmb3
  • Chain 'C':
    Compound: 5'-r(*gp*gp*cp*gp*up*up*gp*cp*cp*gp *gp*up*cp*up*gp*gp*cp*ap*ap*cp*gp*cp*c)-3'
    Species: MOORELLA THERMOACETICA, synthetic [TaxId:1525]
  • Chain 'D':
    Compound: 5'-r(*gp*gp*cp*gp*up*up*gp*cp*cp*gp *gp*up*cp*up*gp*gp*cp*ap*ap*cp*gp*cp*c)-3'
    Species: MOORELLA THERMOACETICA, synthetic [TaxId:1525]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2uwmA (A:)
    gspekilaqiiqehregldwqeaatraslsleetrkllqsmaaagqvtllrvendlyais
    teryqawwqavtraleefhsryplrpglareelrsryfsrlparvyqalleewsregrlq
    laantvalagftpsfsetqkkllkdledkyrvsrwqppsfkevagsfnldpseleellhy
    lvregvlvkindefywhrqalgeareviknlastgpfglaeardalgssrkyvlplleyl
    dqvkftrrvgdkrvvvgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uwmA (A:)
    qawwqavtraleefhsryplrpglareelrsryfsrlparvyqalleewsregrlqlaan
    tvalagftpsfsetqkkllkdledkyrvsrwqppsfkevagsfnldpseleellhylvre
    gvlvkindefywhrqalgeareviknlastgpfglaeardalgssrkyvlplleyldqvk
    ftrrvgdkrvvvg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2uwmB (B:)
    gspekilaqiiqehregldwqeaatraslsleetrkllqsmaaagqvtllrvendlyais
    teryqawwqavtraleefhsryplrpglareelrsryfsrlparvyqalleewsregrlq
    laantvalagftpsfsetqkkllkdledkyrvsrwqppsfkevagsfnldpseleellhy
    lvregvlvkindefywhrqalgeareviknlastgpfglaeardalgssrkyvlplleyl
    dqvkftrrvgdkrvvvgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uwmB (B:)
    dlyaisteryqawwqavtraleefhsryplrpglareelrsryfsrlparvyqalleews
    regrlqlaantvalagftpsfsetqkkllkdledkyrvsrwqppsfkevagsfnldpsel
    eellhylvregvlvkindefywhrqalgeareviknlastgpfglaeardalgssrkyvl
    plleyldqvkftrrvgdkrvvvg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.