PDB entry 2uwa

View 2uwa on RCSB PDB site
Description: crystal structure of the nasturtium seedling xyloglucanase isoform nxg1
Class: hydrolase
Keywords: glycoside hydrolase, xyloglucan-endo-transferase, hydrolase, glycosidase, family gh16, tropaeolum majus xyloglucanase
Deposited on 2007-03-19, released 2007-06-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase
    Species: TROPAEOLUM MAJUS [TaxId:4020]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2UWA (0-2)
    • Uniprot Q07524 (3-273)
    Domains in SCOPe 2.05: d2uwaa_
  • Chain 'B':
    Compound: cellulase
    Species: TROPAEOLUM MAJUS [TaxId:4020]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2UWA (0-2)
    • Uniprot Q07524 (3-273)
    Domains in SCOPe 2.05: d2uwab_
  • Chain 'C':
    Compound: cellulase
    Species: TROPAEOLUM MAJUS [TaxId:4020]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2UWA (0-2)
    • Uniprot Q07524 (3-273)
    Domains in SCOPe 2.05: d2uwac_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uwaA (A:)
    ayvqgppspgyypssqitslgfdqgytnlwgpqhqrvdqgsltiwldstsgsgfksinry
    rsgyfganiklqsgytagvitsfylsnnqdypgkhdeidieflgtipgkpytlqtnvfie
    gsgdyniigremrihlwfdptqdyhnyaiywtpseiiffvddvpirryprksdatfplrp
    lwvygsvwdasswatengkykadyryqpfvgkyedfklgsctveaasscnpasvspygql
    sqqqvaamewvqknymvynycddptrdhtltpec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uwaB (B:)
    ayvqgppspgyypssqitslgfdqgytnlwgpqhqrvdqgsltiwldstsgsgfksinry
    rsgyfganiklqsgytagvitsfylsnnqdypgkhdeidieflgtipgkpytlqtnvfie
    gsgdyniigremrihlwfdptqdyhnyaiywtpseiiffvddvpirryprksdatfplrp
    lwvygsvwdasswatengkykadyryqpfvgkyedfklgsctveaasscnpasvspygql
    sqqqvaamewvqknymvynycddptrdhtltpec
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uwaC (C:)
    ayvqgppspgyypssqitslgfdqgytnlwgpqhqrvdqgsltiwldstsgsgfksinry
    rsgyfganiklqsgytagvitsfylsnnqdypgkhdeidieflgtipgkpytlqtnvfie
    gsgdyniigremrihlwfdptqdyhnyaiywtpseiiffvddvpirryprksdatfplrp
    lwvygsvwdasswatengkykadyryqpfvgkyedfklgsctveaasscnpasvspygql
    sqqqvaamewvqknymvynycddptrdhtltpec