PDB entry 2uw2

View 2uw2 on RCSB PDB site
Description: crystal structure of human ribonucleotide reductase subunit r2
Class: oxidoreductase
Keywords: small subunit ribonucleotide reductase, r2, iron, diiron, radical, r2 subunit, metal-binding, ribonucleotide reductase, oxidoreductase, DNA replication, phosphorylation
Deposited on 2007-03-16, released 2007-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.233
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonucleoside-diphosphate reductase m2 subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UW2
      • conflict (193)
    • Uniprot P31350
    Domains in SCOPe 2.07: d2uw2a1
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2uw2A (A:)
    smtkaaapgvedepllrenprrfvifpieyhdiwqmykkaeasfwtaeevdlskdiqhwe
    slkpeeryfishvlaffaasdgivnenlverfsqevqitearcfygfqiamenihsemys
    llidtyikdpkereflfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffs
    gsfasifwlkkrgpmpgltfsnelisrdeglhcdfaclmfkhlvhkpseervreiiinav
    rieqefltealpvkligmnctlmkqyiefvadrlmlelgfskvfrvenpfdfmenisleg
    ktnffekrvgeyqrmgvmssptensftldadf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uw2A (A:)
    gvedepllrenpifpieyhdiwqmykkaeasfwtaeevdlskdiqhweslkpeeryfish
    vlaffaasdgivnenlverfsqevqitearcfygfqiamenihsemysllidtyikdpke
    reflmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasifwlkkrgpmpgl
    tfsnelisrdeglhcdfaclmfkhlvhkpseervreiiinavrieqefltealpvkligm
    nctlmkqyiefvadrlmlelgfskvfrvenpfdfm