PDB entry 2uuw

View 2uuw on RCSB PDB site
Description: 2.75 angstrom structure of the D347G D348G mutant structure of Sapporo Virus RdRp Polymerase
Class: hydrolase
Keywords: nucleotide-binding, nucleotidyltransferase, covalent protein-RNA linkage, RNA elongation, transferase activity, capsid protein, RNA replication, structural protein, protease, helicase, hydrolase, transferase, RNA-directed RNA polymerase, polyprotein, ATP-binding, thiol protease
Deposited on 2007-03-07, released 2007-05-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: 0.247
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-directed RNA polymerase
    Species: SAPPORO VIRUS [TaxId:95342]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q69014 (0-End)
      • engineered mutation (346-347)
    Domains in SCOPe 2.05: d2uuwa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2uuwA (A:)
    defqwkglpvvksgldvggmptgtryhrspawpeeqpgethapapfgsgdkrytfsqtem
    lvnglkpyteptagvppqllsravthvrsyietiigthrspvltyhqacellerttscgp
    fvqglkgdywdeeqqqytgvlanhleqawdkankgiaprnayklalkdelrpieknkagk
    rrllwgcdaattliataafkavatrlqvvtpmtpvavginmdsvqmqvmndslkggvlyc
    ldyskwdstqnpavtaaslailerfaephpivscaiealsspaegyvndikfvtrgglps
    gmpftsvvnsinhmiyvaaailqayeshnvpytgnvfqvetihtygggcmysvcpatasi
    fhtvlanltsyglkptaadksdaikptntpvflkrtftqtphgirallditsitrqfywl
    kanrtsdpssppafdrqarsaqlenalayasqhgpvmfdtvrqiaiktaqgeglvlvntn
    ydqalatynawfiggtvpdpvghtegthkivfeme
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uuwA (A:)
    defqwkglpvvksgldvggmptgtryhrspawpeeqpgethapapfgsgdkrytfsqtem
    lvnglkpyteptagvppqllsravthvrsyietiigthrspvltyhqacellerttscgp
    fvqglkgdywdeeqqqytgvlanhleqawdkankgiaprnayklalkdelrpieknkagk
    rrllwgcdaattliataafkavatrlqvvtpmtpvavginmdsvqmqvmndslkggvlyc
    ldyskwdstqnpavtaaslailerfaephpivscaiealsspaegyvndikfvtrgglps
    gmpftsvvnsinhmiyvaaailqayeshnvpytgnvfqvetihtygggcmysvcpatasi
    fhtvlanltsyglkptikptntpvflkrtftqtphgirallditsitrqfywlkanrtsd
    pssppafdrqarsaqlenalayasqhgpvmfdtvrqiaiktaqgeglvlvntnydqalat
    ynawfiggtv