PDB entry 2uut

View 2uut on RCSB PDB site
Description: The 2.4 angstrom resolution structure of the D346G mutant of the Sapporo Virus RdRp polymerase
Class: hydrolase
Keywords: nucleotide-binding, nucleotidyltransferase, covalent protein-RNA linkage, polymerase, RNA elongation, transferase activity, mutant, capsid protein, RNA replication, structural protein, protease, helicase, hydrolase, transferase, RNA-directed RNA polymerase, polyprotein, ATP-binding, thiol protease
Deposited on 2007-03-07, released 2007-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-directed RNA polymerase
    Species: SAPPORO VIRUS [TaxId:95342]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q69014 (490-End)
      • engineered mutation (346)
    Domains in SCOPe 2.08: d2uuta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2uutA (A:)
    defqwkglpvvksgldvggmptgtryhrspawpeeqpgethapapfgsgdkrytfsqtem
    lvnglkpyteptagvppqllsravthvrsyietiigthrspvltyhqacellerttscgp
    fvqglkgdywdeeqqqytgvlanhleqawdkankgiaprnayklalkdelrpieknkagk
    rrllwgcdaattliataafkavatrlqvvtpmtpvavginmdsvqmqvmndslkggvlyc
    ldyskwdstqnpavtaaslailerfaephpivscaiealsspaegyvndikfvtrgglps
    gmpftsvvnsinhmiyvaaailqayeshnvpytgnvfqvetihtyggdcmysvcpatasi
    fhtvlanltsyglkptaikptntpvflkrtftqtphgirallditsitrqfywlkanrts
    dpssppafdrqarsaqlenalayasqhgpvmfdtvrqiaiktaqgeglvlvntnydqala
    tynawfiggtpdpvghtegthkivfeme
    

    Sequence, based on observed residues (ATOM records): (download)
    >2uutA (A:)
    defqwkglpvvksgldvggmptgtryhrspawpeeqpgethapapfgsgdkrytfsqtem
    lvnglkpyteptagvppqllsravthvrsyietiigthrspvltyhqacellerttscgp
    fvqglkgdywdeeqqqytgvlanhleqawdkankgiaprnayklalkdelrpieknkagk
    rrllwgcdaattliataafkavatrlqvvtpmtpvavginmdsvqmqvmndslkggvlyc
    ldyskwdstqnpavtaaslailerfaephpivscaiealsspaegyvndikfvtrgglps
    gmpftsvvnsinhmiyvaaailqayeshnvpytgnvfqvetihtyggdcmysvcpatasi
    fhtvlanltsyglkptaikptntpvflkrtftqtphgirallditsitrqfywlkanrts
    dpssppafdrqarsaqlenalayasqhgpvmfdtvrqiaiktaqgeglvlvntnydqala
    tynawfiggtpd