PDB entry 2tss

View 2tss on RCSB PDB site
Description: toxic shock syndrome toxin-1 from staphylococcus aureus: orthorhombicc222(1) crystal form
Deposited on 1996-12-04, released 1997-12-24
The last revision prior to the SCOP 1.57 freeze date was dated 1997-12-24, with a file datestamp of 1997-12-24.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.154
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tssA (A:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tssB (B:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tssC (C:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein