PDB entry 2ts1

View 2ts1 on RCSB PDB site
Description: structure of tyrosyl-t/RNA synthetase refined at 2.3 angstroms resolution. interaction of the enzyme with the tyrosyl adenylate intermediate
Class: ligase (synthetase)
Keywords: ligase (synthetase)
Deposited on 1989-06-29, released 1989-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosyl-tRNA synthetase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ts1a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ts1A (A:)
    mdllaelqwrglvnqttdedglrkllneervtlycgfdptadslhighlatiltmrrfqq
    aghrpialvggatgligdpsgkksertlnaketveawsarikeqlgrfldfeadgnpaki
    knnydwigpldvitflrdvgkhfsvnymmakesvqsrietgisftefsymmlqaydflrl
    yetegcrlqiggsdqwgnitaglelirktkgearafgltiplvtkadgtkfgktesgtiw
    ldkektspyefyqfwintddrdvirylkyftflskeeiealeqelreapekraaqktlae
    evtklvhgeealrqairisealfsgdianltaaeieqgfkdvpsfvheggdvplvellvs
    agispskrqarediqngaiyvngerlqdvgailtaehrlegrftvirrgkkkyylirya
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ts1A (A:)
    mdllaelqwrglvnqttdedglrkllneervtlycgfdptadslhighlatiltmrrfqq
    aghrpialvggatgligdpsgkksertlnaketveawsarikeqlgrfldfeadgnpaki
    knnydwigpldvitflrdvgkhfsvnymmakesvqsrietgisftefsymmlqaydflrl
    yetegcrlqiggsdqwgnitaglelirktkgrafgltiplvtkadgtkfgktesgtiwld
    kektspyefyqfwintddrdvirylkyftflskeeiealeqelreapekraaqktlaeev
    tklvhgeealrqairis