PDB entry 2trx

View 2trx on RCSB PDB site
Description: crystal structure of thioredoxin from escherichia coli at 1.68 angstroms resolution
Deposited on 1990-03-19, released 1991-10-15
The last revision prior to the SCOP 1.67 freeze date was dated 1993-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.68 Å
R-factor: 0.165
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d2trxa_
  • Chain 'B':
    Domains in SCOP 1.67: d2trxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2trxA (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2trxB (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla