PDB entry 2trc

View 2trc on RCSB PDB site
Description: phosducin/transducin beta-gamma complex
Class: complex (transducer/transduction)
Keywords: phosducin, transducin, beta-gamma, signal transduction, regulation, phosphorylation, g proteins, thioredoxin, vision, meka, complex (transducer/transduction)
Deposited on 1997-01-06, released 1997-06-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: transducin
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2trcb_
  • Chain 'G':
    Compound: transducin
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2trcg_
  • Chain 'P':
    Compound: phosducin
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20942 (0-216)
      • modified residue (54)
      • modified residue (58)
      • modified residue (84)
      • modified residue (87)
      • modified residue (150)
    Domains in SCOPe 2.06: d2trcp_
  • Heterogens: GD, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2trcB (B:)
    mseldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiya
    mhwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldni
    csiynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttf
    tghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngna
    fatgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdal
    kadragvlaghdnrvsclgvtddgmavatgswdsflkiwn
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2trcG (G:)
    mpviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped
    knpfkelk
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2trcP (P:)
    egqathtgpkgvindwrkfklesedgdsippskkeilrqmsspqsrddkdskermsrkms
    iqeyelihqdkedegclrkyrrqcmqdmhqklsfgprygfvyeletgeqfletiekeqkv
    ttivvniyedgvrgcdalnssleclaaeypmvkfckirasntgagdrfssdvlptllvyk
    ggelisnfisvaeqfaedffaadvesflneygllper