PDB entry 2tpt

View 2tpt on RCSB PDB site
Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase
Deposited on 1997-11-24, released 1999-03-02
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.207
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tpt_ (-)
    lflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
    mamrdsgtvldwkslhlngpivdkhstggvgdvtslmlgpmvaacggyipmisgrglght
    ggtldklesipgfdifpddnrfreiikdvgvaiigqtsslapadkrfyatrditatvdsi
    plitasilakklaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttallt
    dmnqvlassagnavevreavqfltgeyrnprlfdvtmalcvemlisgklakddaearakl
    qavldngkaaevfgrmvaaqkgptdfvenyakylptamltkavyadtegfvsemdtralg
    mavvamgggrrqasdtidysvgftdmarlgdqvdgqrplavihakdennwqeaakavkaa
    ikladkapestptvyrrise