PDB entry 2tpi

View 2tpi on RCSB PDB site
Description: on the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
Deposited on 1981-10-26, released 1982-03-04
The last revision prior to the SCOP 1.59 freeze date was dated 1991-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Domains in SCOP 1.59: d2tpii_
  • Chain 'Z':
    Domains in SCOP 1.59: d2tpiz_

PDB Chain Sequences:

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tpiI (I:)
    pdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcgga
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tpiZ (Z:)
    gytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvvegneq
    fisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisgwgn
    tkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggpvvc
    sgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn