PDB entry 2tod

View 2tod on RCSB PDB site
Description: ornithine decarboxylase from trypanosoma brucei k69a mutant in complex with alpha-difluoromethylornithine
Class: lyase
Keywords: polyamine metabolism, pyridoxal 5'-phosphate, alpha-beta barrel, lyase
Deposited on 1999-05-18, released 1999-11-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ornithine decarboxylase)
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2toda1, d2toda2
  • Chain 'B':
    Compound: protein (ornithine decarboxylase)
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2todb1, d2todb2
  • Chain 'C':
    Compound: protein (ornithine decarboxylase)
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2todc1, d2todc2
  • Chain 'D':
    Compound: protein (ornithine decarboxylase)
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2todd1, d2todd2
  • Heterogens: PLP, DMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2todA (A:)
    gamdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavacnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakkvtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2todA (A:)
    gdpffvadlgdivrkhetwkkclprvtpfyavacnddwrvlgtlaalgtgfdcasnteiq
    rvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlris
    tlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgte
    lgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaf
    tlavnviakkvtpaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwg
    ptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2todB (B:)
    gamdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavacnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakkvtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2todB (B:)
    gdpffvadlgdivrkhetwkkclprvtpfyavacnddwrvlgtlaalgtgfdcasnteiq
    rvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlris
    tlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgte
    lgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaf
    tlavnviakkvtaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgp
    tcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2todC (C:)
    gamdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavacnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakkvtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2todC (C:)
    gdpffvadlgdivrkhetwkkclprvtpfyavacnddwrvlgtlaalgtgfdcasnteiq
    rvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlris
    tlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgte
    lgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaf
    tlavnviakkvtpaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwg
    ptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2todD (D:)
    gamdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavacnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakkvtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2todD (D:)
    gdpffvadlgdivrkhetwkkclprvtpfyavacnddwrvlgtlaalgtgfdcasnteiq
    rvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlris
    tlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgte
    lgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaf
    tlavnviakkvtpaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwg
    ptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvs