PDB entry 2tmg

View 2tmg on RCSB PDB site
Description: thermotoga maritima glutamate dehydrogenase mutant s128r, t158e, n117r, s160e
Deposited on 1998-12-04, released 1999-12-08
The last revision prior to the SCOP 1.65 freeze date was dated 1999-12-08, with a file datestamp of 1999-12-07.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.211
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2tmgA (A:)
    pekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqh
    nvargpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrele
    rlsrrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelgg
    skgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavs
    dsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaiha
    gnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsff
    wdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tmgA (A:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrelerls
    rrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2tmgB (B:)
    pekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqh
    nvargpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrele
    rlsrrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelgg
    skgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavs
    dsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaiha
    gnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsff
    wdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tmgB (B:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrelerls
    rrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2tmgC (C:)
    pekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqh
    nvargpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrele
    rlsrrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelgg
    skgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavs
    dsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaiha
    gnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsff
    wdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tmgC (C:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrelerls
    rrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2tmgD (D:)
    pekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqh
    nvargpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrele
    rlsrrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelgg
    skgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavs
    dsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaiha
    gnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsff
    wdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tmgD (D:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrelerls
    rrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2tmgE (E:)
    pekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqh
    nvargpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrele
    rlsrrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelgg
    skgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavs
    dsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaiha
    gnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsff
    wdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tmgE (E:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrelerls
    rrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2tmgF (F:)
    pekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqh
    nvargpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrele
    rlsrrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelgg
    skgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavs
    dsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaiha
    gnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsff
    wdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2tmgF (F:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrelerls
    rrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkr