PDB entry 2tir

View 2tir on RCSB PDB site
Description: crystal structure analysis of a mutant escherichia coli thioredoxin in which lysine 36 is replaced by glutamic acid
Deposited on 1993-01-10, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d2tir__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2tir_ (-)
  sdkiihltddsfdtdvlkadgailvdfwaewcgpcemiapildeiadeyqgkltvaklni
  dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla