PDB entry 2tgf

View 2tgf on RCSB PDB site
Description: the solution structure of human transforming growth factor alpha
Deposited on 1991-01-23, released 1993-04-15
The last revision prior to the SCOP 1.59 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d2tgf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tgf_ (-)
    vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla