PDB entry 2spt

View 2spt on RCSB PDB site
Description: differences in the metal ion structure between sr-and ca-prothrombin fragment 1
Class: hydrolase(serine proteinase)
Keywords: hydrolase(serine proteinase)
Deposited on 1994-02-01, released 1994-05-31
The last revision prior to the SCOP 1.75 freeze date was dated 1994-05-31, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.167
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Prothrombin
  Species: Bos taurus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00735 (0-144)
    • conflict (6-7)
    • conflict (14)
    • conflict (16)
    • conflict (19-20)
    • conflict (25-26)
    • conflict (29)
    • conflict (32)
  Domains in SCOP 1.75: d2spta1, d2spta2
• Heterogens: NAG, SR, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2sptA (A:)
  ankgfleevrkgnlerecleepcsreeafealeslsatdafwakytacesarnpreklne
  clegncaegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdg
  sitgpwcyttsptlrreecsvpvcg