PDB entry 2spo

View 2spo on RCSB PDB site
Description: a novel site-directed mutant of myoglobin with an unusually high o2 affinity and low autooxidation rate
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1993-08-25, released 1994-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-03, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.157
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (1-153)
    • conflict (29)
    • conflict (122)
  Domains in SCOP 1.73: d2spoa_
• Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2spoA (A:)
  mvlsegewqlvlhvwakveadvaghgqdivirlfkshpetlekfdrfkhlkteaemkase
  dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg