PDB entry 2sob

View 2sob on RCSB PDB site
Description: sn-ob, ob-fold sub-domain of staphylococcal nuclease, nmr, 10 structures
Deposited on 1995-09-15, released 1995-12-07
The last revision prior to the SCOP 1.65 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.65: d2sob__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2sob_ (-)
  atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
  ftkkmlenakkievefdkgqrtdkygrvlayiyadgkmvneal