PDB entry 2snv

View 2snv on RCSB PDB site
Description: the refined structure of sindbis virus core protein in comparison with other chymotrypsin-like serine proteinase structures
Class: Viral protein
Keywords: Viral protein
Deposited on 1992-07-17, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sindbis virus coat protein
  Species: Sindbis virus [TaxId:11034]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03316 (0-150)
  Domains in SCOPe 2.08: d2snva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2snvA (A:)
  rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
  rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
  adegtrtalsvvtwnskgktikttpegteew