PDB entry 2shp

View 2shp on RCSB PDB site
Description: tyrosine phosphatase shp-2
Class: tyrosine phosphatase
Keywords: tyrosine phosphatase, insulin signaling, sh2 protein
Deposited on 1997-12-01, released 1999-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: shp-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124 (Start-524)
      • engineered (1)
      • engineered (40)
      • engineered (512)
    Domains in SCOPe 2.07: d2shpa1, d2shpa2, d2shpa3
  • Chain 'B':
    Compound: shp-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124 (Start-524)
      • engineered (1)
      • engineered (40)
      • engineered (512)
    Domains in SCOPe 2.07: d2shpb1, d2shpb2, d2shpb3
  • Heterogens: CAT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2shpA (A:)
    mksrrwfhpnitgveaenllltrgvdgsflarpsksnpgdltlsvrrngavthikiqntg
    dyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgk
    eaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelkyd
    vgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaett
    dkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpnep
    vsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttkev
    ergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhf
    rtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiir
    ekgvdcdidvpktiqmvrsqrsgmvqteaqyrsiymavqhyietl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2shpA (A:)
    ksrrwfhpnitgveaenllltrgvdgsflarpsksnpgdltlsvrrngavthikiqntgd
    yydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgke
    aeklltekgkhgsflvresqshpgdfvlsvrtgdndgkskvthvmircqelkydvggger
    fdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelskgfweefetlqq
    qeckllysrkegqrqenknknryknilpfdhtrvvlhdsdyinaniimpkksyiatqgcl
    qntvndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaah
    dytlrelklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagp
    vvvhcsagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrsi
    ymavqhyietl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2shpB (B:)
    mksrrwfhpnitgveaenllltrgvdgsflarpsksnpgdltlsvrrngavthikiqntg
    dyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgk
    eaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelkyd
    vgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaett
    dkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpnep
    vsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttkev
    ergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhf
    rtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiir
    ekgvdcdidvpktiqmvrsqrsgmvqteaqyrsiymavqhyietl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2shpB (B:)
    ksrrwfhpnitgveaenllltrgvdgsflarpsksnpgdltlsvrrngavthikiqntgd
    yydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgke
    aeklltekgkhgsflvresqshpgdfvlsvrtgdndgkskvthvmircqelkydvggger
    fdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelskgfweefetlqq
    qeckllysrkegqrqenknknryknilpfdhtrvvlhdsdyinaniimpkksyiatqgcl
    qntvndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaah
    dytlrelklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagp
    vvvhcsagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrsi
    ymavqhyietl