PDB entry 2sfp

View 2sfp on RCSB PDB site
Description: alanine racemase with bound propionate inhibitor
Deposited on 1999-02-16, released 1999-02-24
The last revision prior to the SCOP 1.61 freeze date was dated 1999-02-24, with a file datestamp of 1999-03-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sfpA (A:)
    dfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrl
    avafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpf
    pihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqy
    trflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplk
    eafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvdgq
    kapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpctisy
    rvpriffrhkrimevrnai
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sfpB (B:)
    dfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrl
    avafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpf
    pihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqy
    trflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplk
    eafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvdgq
    kapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpctisy
    rvpriffrhkrimevrnai