PDB entry 2sem

View 2sem on RCSB PDB site
Description: sem5 sh3 domain complexed with peptoid inhibitor
Class: signaling protein/inhibitor
Keywords: SH3 DOMAIN, INHIBITORS, PEPTOIDS, PROTEIN-PROTEIN RECOGNITION, PROLINE-RICH MOTIFS, SIGNAL TRANSDUCTION, SIGNALING PROTEIN, SIGNALING PROTEIN-INHIBITOR complex
Deposited on 1998-11-02, released 1999-01-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.206
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (sex muscle abnormal protein 5)
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2sema_
  • Chain 'B':
    Compound: protein (sex muscle abnormal protein 5)
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2semb_
  • Chain 'C':
    Compound: protein (sh3 peptoid inhibitor)
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2SEM
  • Chain 'D':
    Compound: protein (sh3 peptoid inhibitor)
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2SEM (Start-7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2semA (A:)
    etkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvcpynsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2semA (A:)
    etkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvcpyn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2semB (B:)
    etkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvcpynsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2semB (B:)
    tkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvcpynsn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.